rpl22 MTSFKLVKYTPRIKKKKSGLRKLARKVPTDRLLKFERVFKAQKRIHMSVFKVQRVLDEIRWRYYEETVMILNLMPYRASYPILKLVYSAAANATHYRDFDKANLFITKAEVSRSTIMNKFRPRARGRSSPIKKTMCHITIVLNIVKKSK This protein binds specifically to 23S rRNA (By similarity). PA117 RK22_ORYSA The globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit, while an extended beta-hairpin is found that lines the wall of the exit tunnel in the center of the 70S ribosome (By similarity). 50S ribosomal protein L22, chloroplastic 149